![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily) multihelical |
![]() | Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families) ![]() duplication: contains two structural repeats |
![]() | Family a.86.1.0: automated matches [254307] (1 protein) not a true family |
![]() | Protein automated matches [254708] (4 species) not a true protein |
![]() | Species Streptomyces avermitilis [TaxId:33903] [380323] (1 PDB entry) |
![]() | Domain d6j2ub_: 6j2u B: [380324] Other proteins in same PDB: d6j2ua_ automated match to d4hd7a_ complexed with zn |
PDB Entry: 6j2u (more details), 1.3 Å
SCOPe Domain Sequences for d6j2ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6j2ub_ a.86.1.0 (B:) automated matches {Streptomyces avermitilis [TaxId: 33903]} tvrknqatltadekrrfvdalvalkrsgrydefvtthnafimgdtdsgertghrspsflp whrrfliefeqalqavdpsvalpywdwstdrtaraslwapdflggsgrsldgrvmdgpfa astgnwpvnvrvdsrtylrrtlggggrelptraevdsvlamstydmapwnsasdgfrnhl egwrgvnlhnrvhvwvggqmatgvspndpvfwlhhayidrlwaqwqsrhpgsgyvptggt pnvvdlnetmkpwndvrpadlldhtahytfdtv
Timeline for d6j2ub_: