SCOPe 2.07: Domain d6j2ub_: 6j2u B:

Lineage for d6j2ub_ (6j2u B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
   multihelical

4. Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families)
   duplication: contains two structural repeats

5. Family a.86.1.0: automated matches [254307] (1 protein)
   not a true family

6. Protein automated matches [254708] (4 species)
   not a true protein

7. Species Streptomyces avermitilis [TaxId:33903] [380323] (1 PDB entry)

8. Domain d6j2ub_: 6j2u B: [380324]
   Other proteins in same PDB: d6j2ua_
   automated match to d4hd7a_
   complexed with zn

Details for d6j2ub_

PDB Entry: 6j2u, 1.3 Å

PDB Description: crystal structure of tyrosinase caddy protein(melc1)with tyrosinase (melc2)from streptomyces avermitilis in complex with zinc ion

PDB Compounds: (B:) tyrosinase

SCOPe Domain Sequences for d6j2ub_:

Sequence; same for both SEQRES and ATOM records:

>d6j2ub_ a.86.1.0 (B:) automated matches {Streptomyces avermitilis [TaxId: 33903]}
tvrknqatltadekrrfvdalvalkrsgrydefvtthnafimgdtdsgertghrspsflp
whrrfliefeqalqavdpsvalpywdwstdrtaraslwapdflggsgrsldgrvmdgpfa
astgnwpvnvrvdsrtylrrtlggggrelptraevdsvlamstydmapwnsasdgfrnhl
egwrgvnlhnrvhvwvggqmatgvspndpvfwlhhayidrlwaqwqsrhpgsgyvptggt
pnvvdlnetmkpwndvrpadlldhtahytfdtv

Timeline for d6j2ub_:

• d6j2ub_ is new in SCOPe 2.07-stable
  
• d6j2ub_ appears in the current release, SCOPe 2.08