Lineage for d6ed0b_ (6ed0 B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.227: OsmC-like [82783] (1 superfamily)
    swapped dimer of beta(3)-alpha-beta(2)-alpha(2)-beta subunits; mixed beta-sheet; order: 321[4][5][6]; buried helix
  4. Superfamily d.227.1: OsmC-like [82784] (3 families) (S)
  5. Family d.227.1.1: Ohr/OsmC resistance proteins [82785] (8 proteins)
  6. Protein automated matches [229446] (3 species)
    not a true protein
  7. Species Chromobacterium violaceum [TaxId:243365] [380315] (2 PDB entries)
  8. Domain d6ed0b_: 6ed0 B: [380322]
    Other proteins in same PDB: d6ed0a2
    automated match to d4xx2a_
    complexed with so4; mutant

Details for d6ed0b_

PDB Entry: 6ed0 (more details), 1.44 Å

PDB Description: ohra (organic hydroperoxide resistance protein) mutant (c61s) in the "open conformation" from chromobacterium violaceum
PDB Compounds: (B:) organic hydroperoxide resistance protein

SCOPe Domain Sequences for d6ed0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ed0b_ d.227.1.1 (B:) automated matches {Chromobacterium violaceum [TaxId: 243365]}
mnplqkvlytaeatatggrdgraessdgalqvklstprelgglggdgtnpeqlfaagysa
sfigalkvaaqqagvrlpaevsvtgkvsigpiahgfgiaaklavslpglerdaglrliea
ahgicpysnatrgnieveltla

SCOPe Domain Coordinates for d6ed0b_ are not available.

Timeline for d6ed0b_:

Domains from other chains:
(mouse over for more information)
d6ed0a1, d6ed0a2