Class a: All alpha proteins [46456] (289 folds) |
Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) multihelical; consists of two all-alpha domains |
Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) |
Family a.93.1.1: CCP-like [48114] (5 proteins) |
Protein Cytochrome c peroxidase, CCP [48119] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (205 PDB entries) Uniprot P00431 |
Domain d6h08b1: 6h08 B:4-294 [380317] Other proteins in same PDB: d6h08a2, d6h08b2, d6h08c2 automated match to d1s73a_ complexed with co, hem, mn, na |
PDB Entry: 6h08 (more details), 1.9 Å
SCOPe Domain Sequences for d6h08b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6h08b1 a.93.1.1 (B:4-294) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhtsgtwdkhdnt ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk ipwrcgrvdtpedttpdngrlpdadkdadyvrtffqrlnmndrevvalmgahalgkthlk nsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
Timeline for d6h08b1:
View in 3D Domains from other chains: (mouse over for more information) d6h08a1, d6h08a2, d6h08c1, d6h08c2 |