Lineage for d1d6ua2 (1d6u A:91-185)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1404616Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1404785Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 1404786Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 1404787Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 1404917Species Escherichia coli [TaxId:562] [54419] (16 PDB entries)
  8. 1404954Domain d1d6ua2: 1d6u A:91-185 [38031]
    Other proteins in same PDB: d1d6ua1, d1d6ua4, d1d6ub1, d1d6ub4
    complexed with ca, cu, gol, hy1, pea

Details for d1d6ua2

PDB Entry: 1d6u (more details), 2.4 Å

PDB Description: crystal structure of e. coli amine oxidase anaerobically reduced with beta-phenylethylamine
PDB Compounds: (A:) copper amine oxidase

SCOPe Domain Sequences for d1d6ua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d6ua2 d.17.2.1 (A:91-185) Copper amine oxidase, domains 1 and 2 {Escherichia coli [TaxId: 562]}
krphplnaltadeikqaveivkasadfkpntrfteisllppdkeavwafalenkpvdqpr
kadvimldgkhiieavvdlqnnkllswqpikdahg

SCOPe Domain Coordinates for d1d6ua2:

Click to download the PDB-style file with coordinates for d1d6ua2.
(The format of our PDB-style files is described here.)

Timeline for d1d6ua2: