![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
![]() | Protein automated matches [190396] (40 species) not a true protein |
![]() | Species Simian immunodeficiency virus [TaxId:11723] [380162] (3 PDB entries) |
![]() | Domain d6rwnk2: 6rwn K:57-217 [380295] Other proteins in same PDB: d6rwnc1, d6rwnd1, d6rwnd2, d6rwne1, d6rwne2, d6rwnf1, d6rwnk1, d6rwnl1, d6rwnl2, d6rwnm1, d6rwnm2, d6rwnn1 automated match to d1k6ya2 protein/DNA complex; complexed with cl, dlu, mg, zn |
PDB Entry: 6rwn (more details), 3.1 Å
SCOPe Domain Sequences for d6rwnk2:
Sequence, based on SEQRES records: (download)
>d6rwnk2 c.55.3.0 (K:57-217) automated matches {Simian immunodeficiency virus [TaxId: 11723]} spktwqmdcthlegkviivavhvasgyieaevlpaetgketahfllklaarwpvkhlhtd ngdnftssavqavcwwaqiehtfgvpynpqsqgvvesmnhqlktiitqirdqaekietav qmavlihnfkrkggiggysageriidiiasdlqttklqnqi
>d6rwnk2 c.55.3.0 (K:57-217) automated matches {Simian immunodeficiency virus [TaxId: 11723]} spktwqmdcthlegkviivavhvasgyieaevlpaetgketahfllklaarwpvkhlhtd ngdnftssavqavcwwaqiehtfggvvesmnhqlktiitqirdqaekietavqmavlihn fkrkggiggysageriidiiasdlqttklqnqi
Timeline for d6rwnk2: