Lineage for d6rwnk1 (6rwn K:4-43)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2309001Superfamily a.4.10: N-terminal Zn binding domain of HIV integrase [46919] (2 families) (S)
  5. 2309029Family a.4.10.0: automated matches [380158] (1 protein)
    not a true family
  6. 2309030Protein automated matches [380159] (1 species)
    not a true protein
  7. 2309031Species Simian immunodeficiency virus [TaxId:11723] [380160] (3 PDB entries)
  8. 2309042Domain d6rwnk1: 6rwn K:4-43 [380294]
    Other proteins in same PDB: d6rwnc2, d6rwnd1, d6rwnd2, d6rwne2, d6rwnf1, d6rwnk2, d6rwnl1, d6rwnl2, d6rwnm2, d6rwnn1
    automated match to d1k6ya1
    protein/DNA complex; complexed with cl, dlu, mg, zn

Details for d6rwnk1

PDB Entry: 6rwn (more details), 3.1 Å

PDB Description: sivrcm intasome in complex with dolutegravir
PDB Compounds: (K:) pol protein

SCOPe Domain Sequences for d6rwnk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rwnk1 a.4.10.0 (K:4-43) automated matches {Simian immunodeficiency virus [TaxId: 11723]}
giekaqeehekyhnnwramaedfqipqvvakeivaqcpkc

SCOPe Domain Coordinates for d6rwnk1:

Click to download the PDB-style file with coordinates for d6rwnk1.
(The format of our PDB-style files is described here.)

Timeline for d6rwnk1: