Lineage for d1qafa2 (1qaf A:91-185)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 599696Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 599780Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 599781Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 599782Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 599832Species Escherichia coli [TaxId:562] [54419] (11 PDB entries)
  8. 599853Domain d1qafa2: 1qaf A:91-185 [38027]
    Other proteins in same PDB: d1qafa1, d1qafa4, d1qafb1, d1qafb4

Details for d1qafa2

PDB Entry: 1qaf (more details), 2.2 Å

PDB Description: the active site base controls cofactor reactivity in escherichia coli amine oxidase : x-ray crystallographic studies with mutational variants

SCOP Domain Sequences for d1qafa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qafa2 d.17.2.1 (A:91-185) Copper amine oxidase, domains 1 and 2 {Escherichia coli}
krphplnaltadeikqaveivkasadfkpntrfteisllppdkeavwafalenkpvdqpr
kadvimldgkhiieavvdlqnnkllswqpikdahg

SCOP Domain Coordinates for d1qafa2:

Click to download the PDB-style file with coordinates for d1qafa2.
(The format of our PDB-style files is described here.)

Timeline for d1qafa2: