![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily) mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix |
![]() | Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) ![]() duplication: consists of two similar domain swapped with C-terminal strands |
![]() | Family d.21.1.1: Diaminopimelate epimerase [54507] (2 proteins) automatically mapped to Pfam PF01678 |
![]() | Protein automated matches [352381] (2 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [353391] (4 PDB entries) |
![]() | Domain d6vcla1: 6vcl A:1-130 [380246] Other proteins in same PDB: d6vcla3 automated match to d4ijza1 protein/RNA complex; complexed with 0o2, cl, f, gol, mg |
PDB Entry: 6vcl (more details), 2.06 Å
SCOPe Domain Sequences for d6vcla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6vcla1 d.21.1.1 (A:1-130) automated matches {Escherichia coli [TaxId: 83333]} mqfskmhglgndfmvvdavtqnvffspelirrladahlgvgfdqllvveppydpeldfhy rifnadgsevaqcgngarcfarfvrlkgltnkrdirvstangrmvltvtdddlvrvnmge pnfepsavpf
Timeline for d6vcla1: