Lineage for d6vcla1 (6vcl A:1-130)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2546594Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 2546595Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 2546596Family d.21.1.1: Diaminopimelate epimerase [54507] (2 proteins)
    automatically mapped to Pfam PF01678
  6. 2546645Protein automated matches [352381] (2 species)
    not a true protein
  7. 2546651Species Escherichia coli [TaxId:83333] [353391] (4 PDB entries)
  8. 2546652Domain d6vcla1: 6vcl A:1-130 [380246]
    Other proteins in same PDB: d6vcla3
    automated match to d4ijza1
    protein/RNA complex; complexed with 0o2, cl, f, gol, mg

Details for d6vcla1

PDB Entry: 6vcl (more details), 2.06 Å

PDB Description: crystal structure of e.coli rpph-dapf in complex with pppgpp, mg2+ and f-
PDB Compounds: (A:) Diaminopimelate epimerase

SCOPe Domain Sequences for d6vcla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vcla1 d.21.1.1 (A:1-130) automated matches {Escherichia coli [TaxId: 83333]}
mqfskmhglgndfmvvdavtqnvffspelirrladahlgvgfdqllvveppydpeldfhy
rifnadgsevaqcgngarcfarfvrlkgltnkrdirvstangrmvltvtdddlvrvnmge
pnfepsavpf

SCOPe Domain Coordinates for d6vcla1:

Click to download the PDB-style file with coordinates for d6vcla1.
(The format of our PDB-style files is described here.)

Timeline for d6vcla1: