SCOPe 2.07: Domain d6ul5a1: 6ul5 A:-1-429

Lineage for d6ul5a1 (6ul5 A:-1-429)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.2: Reverse transcriptase [56686] (3 proteins)

6. Protein automated matches [190211] (7 species)
   not a true protein

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [380243] (2 PDB entries)

8. Domain d6ul5a1: 6ul5 A:-1-429 [380244]
   Other proteins in same PDB: d6ul5a2, d6ul5b_
   automated match to d2be2a1
   complexed with edo, mg, qag, so4

Details for d6ul5a1

PDB Entry: 6ul5, 2.23 Å

PDB Description: crystal structure of hiv-1 reverse transcriptase (rt) in complex with 4-[(4-{4-[(e)-2-cyanoethenyl]-2,6-dimethylphenoxy}thieno[3,2- d]pyrimidin-2-yl)amino]-2-fluorobenzonitrile (24b), a non-nucleoside rt inhibitor

PDB Compounds: (A:) Reverse transcriptase p66

SCOPe Domain Sequences for d6ul5a1:

Sequence; same for both SEQRES and ATOM records:

>d6ul5a1 e.8.1.2 (A:-1-429) automated matches {Human immunodeficiency virus type 1 [TaxId: 11676]}
mvpispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpynt
pvfaikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsv
pldedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfaaqnpdi
viyqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdk
wtvqpivlpekdswtvndiqklvgklnwasqiypgikvrqlskllrgtkaltevipltee
aelelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmr
gahtndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvn
tpplvklwyql

Timeline for d6ul5a1:

• d6ul5a1 is new in SCOPe 2.07-stable
  
• d6ul5a1 appears in the current release, SCOPe 2.08