Lineage for d1spua3 (1spu A:186-300)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2180921Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2181140Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 2181141Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 2181142Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 2181272Species Escherichia coli [TaxId:562] [54419] (16 PDB entries)
  8. 2181294Domain d1spua3: 1spu A:186-300 [38024]
    Other proteins in same PDB: d1spua1, d1spua4, d1spub1, d1spub4
    complexed with ca, cu

Details for d1spua3

PDB Entry: 1spu (more details), 2 Å

PDB Description: structure of oxidoreductase
PDB Compounds: (A:) copper amine oxidase

SCOPe Domain Sequences for d1spua3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1spua3 d.17.2.1 (A:186-300) Copper amine oxidase, domains 1 and 2 {Escherichia coli [TaxId: 562]}
mvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllkv
isyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrva

SCOPe Domain Coordinates for d1spua3:

Click to download the PDB-style file with coordinates for d1spua3.
(The format of our PDB-style files is described here.)

Timeline for d1spua3: