![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.7: DNA-binding domain of retroviral integrase [50122] (2 families) ![]() |
![]() | Family b.34.7.1: DNA-binding domain of retroviral integrase [50123] (2 proteins) |
![]() | Protein automated matches [347599] (2 species) not a true protein |
![]() | Species Simian immunodeficiency virus [TaxId:11723] [380156] (3 PDB entries) |
![]() | Domain d6rwml2: 6rwm L:223-272 [380239] Other proteins in same PDB: d6rwmc1, d6rwmc2, d6rwmd1, d6rwme1, d6rwme2, d6rwmk1, d6rwmk2, d6rwml1, d6rwmm1, d6rwmm2 automated match to d1ex4a1 protein/DNA complex; complexed with cl, klq, mg, zn |
PDB Entry: 6rwm (more details), 2.81 Å
SCOPe Domain Sequences for d6rwml2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6rwml2 b.34.7.1 (L:223-272) automated matches {Simian immunodeficiency virus [TaxId: 11723]} frvyfregrdqqwkgpatliwkgegavviqdgqdlkvvprrkckiikdyg
Timeline for d6rwml2: