![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.7: DNA-binding domain of retroviral integrase [50122] (2 families) ![]() |
![]() | Family b.34.7.1: DNA-binding domain of retroviral integrase [50123] (2 proteins) |
![]() | Protein automated matches [347599] (2 species) not a true protein |
![]() | Species Simian immunodeficiency virus [TaxId:11723] [380156] (3 PDB entries) |
![]() | Domain d6rwnl2: 6rwn L:223-272 [380221] Other proteins in same PDB: d6rwnc1, d6rwnc2, d6rwnd1, d6rwne1, d6rwne2, d6rwnk1, d6rwnk2, d6rwnl1, d6rwnm1, d6rwnm2 automated match to d1ex4a1 protein/DNA complex; complexed with cl, dlu, mg, zn |
PDB Entry: 6rwn (more details), 3.1 Å
SCOPe Domain Sequences for d6rwnl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6rwnl2 b.34.7.1 (L:223-272) automated matches {Simian immunodeficiency virus [TaxId: 11723]} frvyfregrdqqwkgpatliwkgegavviqdgqdlkvvprrkckiikdyg
Timeline for d6rwnl2: