Lineage for d6rwnl1 (6rwn L:57-222)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2493668Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2493948Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
  6. 2493949Protein Retroviral integrase, catalytic domain [53108] (4 species)
  7. 2494101Species Simian immunodeficiency virus [TaxId:11723] [53111] (3 PDB entries)
  8. 2494105Domain d6rwnl1: 6rwn L:57-222 [380220]
    Other proteins in same PDB: d6rwnc1, d6rwnc2, d6rwnd2, d6rwne1, d6rwne2, d6rwnf1, d6rwnk1, d6rwnk2, d6rwnl2, d6rwnm1, d6rwnm2, d6rwnn1
    automated match to d1ex4b2
    protein/DNA complex; complexed with cl, dlu, mg, zn

Details for d6rwnl1

PDB Entry: 6rwn (more details), 3.1 Å

PDB Description: sivrcm intasome in complex with dolutegravir
PDB Compounds: (L:) pol protein

SCOPe Domain Sequences for d6rwnl1:

Sequence, based on SEQRES records: (download)

>d6rwnl1 c.55.3.2 (L:57-222) Retroviral integrase, catalytic domain {Simian immunodeficiency virus [TaxId: 11723]}
spktwqmdcthlegkviivavhvasgyieaevlpaetgketahfllklaarwpvkhlhtd
ngdnftssavqavcwwaqiehtfgvpynpqsqgvvesmnhqlktiitqirdqaekietav
qmavlihnfkrkggiggysageriidiiasdlqttklqnqiskiqn

Sequence, based on observed residues (ATOM records): (download)

>d6rwnl1 c.55.3.2 (L:57-222) Retroviral integrase, catalytic domain {Simian immunodeficiency virus [TaxId: 11723]}
spktwqmdcthlegkviivavhvasgyieaevlpaetgketahfllklaarwpvkhlhtd
ngdnftssavqavcwwaqiehtfgvvesmnhqlktiitqirdqaekietavqmavlihnf
krkggiggysageriidiiasdlqttklqnqiskiqn

SCOPe Domain Coordinates for d6rwnl1:

Click to download the PDB-style file with coordinates for d6rwnl1.
(The format of our PDB-style files is described here.)

Timeline for d6rwnl1: