Lineage for d1dyub2 (1dyu B:91-185)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 30954Fold d.17: Cystatin-like [54402] (5 superfamilies)
  4. 30987Superfamily d.17.2: Copper amine oxidase, domains 1 and 2 [54416] (1 family) (S)
  5. 30988Family d.17.2.1: Copper amine oxidase, domains 1 and 2 [54417] (1 protein)
  6. 30989Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 30997Species Escherichia coli [TaxId:562] [54419] (9 PDB entries)
  8. 31012Domain d1dyub2: 1dyu B:91-185 [38021]
    Other proteins in same PDB: d1dyua1, d1dyua4, d1dyub1, d1dyub4

Details for d1dyub2

PDB Entry: 1dyu (more details), 2.04 Å

PDB Description: the active site base controls cofactor reactivity in escherichia coli amine oxidase: x-ray crystallographic studies with mutational variants.

SCOP Domain Sequences for d1dyub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dyub2 d.17.2.1 (B:91-185) Copper amine oxidase, domains 1 and 2 {Escherichia coli}
krphplnaltadeikqaveivkasadfkpntrfteisllppdkeavwafalenkpvdqpr
kadvimldgkhiieavvdlqnnkllswqpikdahg

SCOP Domain Coordinates for d1dyub2:

Click to download the PDB-style file with coordinates for d1dyub2.
(The format of our PDB-style files is described here.)

Timeline for d1dyub2: