SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1dyua3 (1dyu A:186-300)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2161468Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2161683Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 2161684Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 protein domains)
    duplication: contains two domains of this fold
  6. 2161685Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 2161815Species Escherichia coli [TaxId:562] [54419] (16 PDB entries)
  8. 2161829Domain d1dyua3: 1dyu A:186-300 [38020]
    Other proteins in same PDB: d1dyua1, d1dyua4, d1dyub1, d1dyub4
    complexed with ca, cu; mutant

Details for d1dyua3

PDB Entry: 1dyu (more details), 2.04 Å

PDB Description: the active site base controls cofactor reactivity in escherichia coli amine oxidase: x-ray crystallographic studies with mutational variants.
PDB Compounds: (A:) copper amine oxidase

SCOPe Domain Sequences for d1dyua3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dyua3 d.17.2.1 (A:186-300) Copper amine oxidase, domains 1 and 2 {Escherichia coli [TaxId: 562]}
mvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllkv
isyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrva

SCOPe Domain Coordinates for d1dyua3:

Click to download the PDB-style file with coordinates for d1dyua3.
(The format of our PDB-style files is described here.)

Timeline for d1dyua3: