SCOPe 2.08: Domain d6rwmd2: 6rwm D:223-272

Lineage for d6rwmd2 (6rwm D:223-272)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.7: DNA-binding domain of retroviral integrase [50122] (2 families)

5. Family b.34.7.1: DNA-binding domain of retroviral integrase [50123] (1 protein)
   Pfam PF00552, Pfam PF18103

6. Protein DNA-binding domain of retroviral integrase [50124] (4 species)

7. Species Simian immunodeficiency virus [TaxId:11723] [50127] (4 PDB entries)

8. Domain d6rwmd2: 6rwm D:223-272 [380199]
   Other proteins in same PDB: d6rwmc1, d6rwmc2, d6rwmd1, d6rwme1, d6rwme2, d6rwmk1, d6rwmk2, d6rwml1, d6rwmm1, d6rwmm2
   automated match to d1ex4a1
   protein/DNA complex; complexed with cl, klq, mg, zn

Details for d6rwmd2

PDB Entry: 6rwm, 2.81 Å

PDB Description: sivrcm intasome in complex with bictegravir

PDB Compounds: (D:) pol protein

SCOPe Domain Sequences for d6rwmd2:

Sequence; same for both SEQRES and ATOM records:

>d6rwmd2 b.34.7.1 (D:223-272) DNA-binding domain of retroviral integrase {Simian immunodeficiency virus [TaxId: 11723]}
frvyfregrdqqwkgpatliwkgegavviqdgqdlkvvprrkckiikdyg

Timeline for d6rwmd2:

• d6rwmd2 first appeared in SCOPe 2.07