Lineage for d6rwmd1 (6rwm D:57-222)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2493668Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2493948Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)
  6. 2493949Protein Retroviral integrase, catalytic domain [53108] (4 species)
  7. 2494101Species Simian immunodeficiency virus [TaxId:11723] [53111] (3 PDB entries)
  8. 2494102Domain d6rwmd1: 6rwm D:57-222 [380198]
    Other proteins in same PDB: d6rwmc1, d6rwmc2, d6rwmd2, d6rwme1, d6rwme2, d6rwmf1, d6rwmk1, d6rwmk2, d6rwml2, d6rwmm1, d6rwmm2, d6rwmn1
    automated match to d1ex4b2
    protein/DNA complex; complexed with cl, klq, mg, zn

Details for d6rwmd1

PDB Entry: 6rwm (more details), 2.81 Å

PDB Description: sivrcm intasome in complex with bictegravir
PDB Compounds: (D:) pol protein

SCOPe Domain Sequences for d6rwmd1:

Sequence, based on SEQRES records: (download)

>d6rwmd1 c.55.3.2 (D:57-222) Retroviral integrase, catalytic domain {Simian immunodeficiency virus [TaxId: 11723]}
spktwqmdcthlegkviivavhvasgyieaevlpaetgketahfllklaarwpvkhlhtd
ngdnftssavqavcwwaqiehtfgvpynpqsqgvvesmnhqlktiitqirdqaekietav
qmavlihnfkrkggiggysageriidiiasdlqttklqnqiskiqn

Sequence, based on observed residues (ATOM records): (download)

>d6rwmd1 c.55.3.2 (D:57-222) Retroviral integrase, catalytic domain {Simian immunodeficiency virus [TaxId: 11723]}
spktwqmdcthlegkviivavhvasgyieaevlpaetgketahfllklaarwpvkhlhtd
ngdnftssavqavcwwaqiehtfgvvesmnhqlktiitqirdqaekietavqmavlihnf
krkggiggysageriidiiasdlqttklqnqiskiqn

SCOPe Domain Coordinates for d6rwmd1:

Click to download the PDB-style file with coordinates for d6rwmd1.
(The format of our PDB-style files is described here.)

Timeline for d6rwmd1: