SCOPe 2.07: Domain d6rwmd1: 6rwm D:57-222

Lineage for d6rwmd1 (6rwm D:57-222)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.2: Retroviral integrase, catalytic domain [53107] (2 proteins)

6. Protein Retroviral integrase, catalytic domain [53108] (4 species)

7. Species Simian immunodeficiency virus [TaxId:11723] [53111] (3 PDB entries)

8. Domain d6rwmd1: 6rwm D:57-222 [380198]
   Other proteins in same PDB: d6rwmc1, d6rwmc2, d6rwmd2, d6rwme1, d6rwme2, d6rwmf1, d6rwmk1, d6rwmk2, d6rwml2, d6rwmm1, d6rwmm2, d6rwmn1
   automated match to d1ex4b2
   protein/DNA complex; complexed with cl, klq, mg, zn

Details for d6rwmd1

PDB Entry: 6rwm, 2.81 Å

PDB Description: sivrcm intasome in complex with bictegravir

PDB Compounds: (D:) pol protein

SCOPe Domain Sequences for d6rwmd1:

Sequence, based on SEQRES records:

>d6rwmd1 c.55.3.2 (D:57-222) Retroviral integrase, catalytic domain {Simian immunodeficiency virus [TaxId: 11723]}
spktwqmdcthlegkviivavhvasgyieaevlpaetgketahfllklaarwpvkhlhtd
ngdnftssavqavcwwaqiehtfgvpynpqsqgvvesmnhqlktiitqirdqaekietav
qmavlihnfkrkggiggysageriidiiasdlqttklqnqiskiqn

Sequence, based on observed residues (ATOM records):

>d6rwmd1 c.55.3.2 (D:57-222) Retroviral integrase, catalytic domain {Simian immunodeficiency virus [TaxId: 11723]}
spktwqmdcthlegkviivavhvasgyieaevlpaetgketahfllklaarwpvkhlhtd
ngdnftssavqavcwwaqiehtfgvvesmnhqlktiitqirdqaekietavqmavlihnf
krkggiggysageriidiiasdlqttklqnqiskiqn

Timeline for d6rwmd1:

• d6rwmd1 is new in SCOPe 2.07-stable
  
• d6rwmd1 appears in the current release, SCOPe 2.08