Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.2: Amine oxidase N-terminal region [54416] (2 families) |
Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins) duplication: contains two domains of this fold |
Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species) |
Species Escherichia coli [TaxId:562] [54419] (16 PDB entries) |
Domain d1dyua2: 1dyu A:91-185 [38019] Other proteins in same PDB: d1dyua1, d1dyua4, d1dyub1, d1dyub4 complexed with ca, cu; mutant |
PDB Entry: 1dyu (more details), 2.04 Å
SCOPe Domain Sequences for d1dyua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dyua2 d.17.2.1 (A:91-185) Copper amine oxidase, domains 1 and 2 {Escherichia coli [TaxId: 562]} krphplnaltadeikqaveivkasadfkpntrfteisllppdkeavwafalenkpvdqpr kadvimldgkhiieavvdlqnnkllswqpikdahg
Timeline for d1dyua2:
View in 3D Domains from other chains: (mouse over for more information) d1dyub1, d1dyub2, d1dyub3, d1dyub4 |