SCOPe 2.07: Domain d6rwnm1: 6rwn M:1-46

Lineage for d6rwnm1 (6rwn M:1-46)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.10: N-terminal Zn binding domain of HIV integrase [46919] (2 families)

5. Family a.4.10.0: automated matches [380158] (1 protein)
   not a true family

6. Protein automated matches [380159] (1 species)
   not a true protein

7. Species Simian immunodeficiency virus [TaxId:11723] [380160] (3 PDB entries)

8. Domain d6rwnm1: 6rwn M:1-46 [380180]
   Other proteins in same PDB: d6rwnc2, d6rwnd1, d6rwnd2, d6rwne2, d6rwnf1, d6rwnk2, d6rwnl1, d6rwnl2, d6rwnm2, d6rwnn1
   automated match to d1wjba_
   protein/DNA complex; complexed with cl, dlu, mg, zn

Details for d6rwnm1

PDB Entry: 6rwn, 3.1 Å

PDB Description: sivrcm intasome in complex with dolutegravir

PDB Compounds: (M:) pol protein

SCOPe Domain Sequences for d6rwnm1:

Sequence; same for both SEQRES and ATOM records:

>d6rwnm1 a.4.10.0 (M:1-46) automated matches {Simian immunodeficiency virus [TaxId: 11723]}
fldgiekaqeehekyhnnwramaedfqipqvvakeivaqcpkcqvk

Timeline for d6rwnm1:

• d6rwnm1 is new in SCOPe 2.07-stable
  
• d6rwnm1 appears in the current release, SCOPe 2.08