Lineage for d6rwod1 (6rwo D:57-222)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2491249Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2493668Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) (S)
    consists of one domain of this fold
  5. 2495032Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2495033Protein automated matches [190396] (40 species)
    not a true protein
  7. 2495319Species Simian immunodeficiency virus [TaxId:11723] [380162] (3 PDB entries)
  8. 2495323Domain d6rwod1: 6rwo D:57-222 [380177]
    Other proteins in same PDB: d6rwoc1, d6rwod2, d6rwoe1, d6rwoe2, d6rwof1, d6rwok1, d6rwol2, d6rwom1, d6rwom2, d6rwon1
    automated match to d1ex4b2
    protein/DNA complex; complexed with cl, klq, mg, zn

Details for d6rwod1

PDB Entry: 6rwo (more details), 3.05 Å

PDB Description: sivrcm intasome (q148h/g140s) in complex with bictegravir
PDB Compounds: (D:) pol protein

SCOPe Domain Sequences for d6rwod1:

Sequence, based on SEQRES records: (download)

>d6rwod1 c.55.3.0 (D:57-222) automated matches {Simian immunodeficiency virus [TaxId: 11723]}
spktwqmdcthlegkviivavhvasgyieaevlpaetgketahfllklaarwpvkhlhtd
ngdnftssavqavcwwaqiehtfsvpynpqshgvvesmnhqlktiitqirdqaekietav
qmavlihnfkrkggiggysageriidiiasdlqttklqnqiskiqn

Sequence, based on observed residues (ATOM records): (download)

>d6rwod1 c.55.3.0 (D:57-222) automated matches {Simian immunodeficiency virus [TaxId: 11723]}
spktwqmdcthlegkviivavhvasgyieaevlpaetgketahfllklaarwpvkhlhtd
ngdnftssavqavcwwaqiehtfsvvesmnhqlktiitqirdqaekietavqmavlihnf
krkggiggysageriidiiasdlqttklqnqiskiqn

SCOPe Domain Coordinates for d6rwod1:

Click to download the PDB-style file with coordinates for d6rwod1.
(The format of our PDB-style files is described here.)

Timeline for d6rwod1: