![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (16 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.0: automated matches [191357] (1 protein) not a true family |
![]() | Protein automated matches [190396] (40 species) not a true protein |
![]() | Species Simian immunodeficiency virus [TaxId:11723] [380162] (3 PDB entries) |
![]() | Domain d6rwod1: 6rwo D:57-222 [380177] Other proteins in same PDB: d6rwoc1, d6rwod2, d6rwoe1, d6rwoe2, d6rwof1, d6rwok1, d6rwol2, d6rwom1, d6rwom2, d6rwon1 automated match to d1ex4b2 protein/DNA complex; complexed with cl, klq, mg, zn |
PDB Entry: 6rwo (more details), 3.05 Å
SCOPe Domain Sequences for d6rwod1:
Sequence, based on SEQRES records: (download)
>d6rwod1 c.55.3.0 (D:57-222) automated matches {Simian immunodeficiency virus [TaxId: 11723]} spktwqmdcthlegkviivavhvasgyieaevlpaetgketahfllklaarwpvkhlhtd ngdnftssavqavcwwaqiehtfsvpynpqshgvvesmnhqlktiitqirdqaekietav qmavlihnfkrkggiggysageriidiiasdlqttklqnqiskiqn
>d6rwod1 c.55.3.0 (D:57-222) automated matches {Simian immunodeficiency virus [TaxId: 11723]} spktwqmdcthlegkviivavhvasgyieaevlpaetgketahfllklaarwpvkhlhtd ngdnftssavqavcwwaqiehtfsvvesmnhqlktiitqirdqaekietavqmavlihnf krkggiggysageriidiiasdlqttklqnqiskiqn
Timeline for d6rwod1: