Lineage for d1d6zb2 (1d6z B:91-185)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 78424Fold d.17: Cystatin-like [54402] (5 superfamilies)
  4. 78463Superfamily d.17.2: Copper amine oxidase, domains 1 and 2 [54416] (1 family) (S)
  5. 78464Family d.17.2.1: Copper amine oxidase, domains 1 and 2 [54417] (1 protein)
  6. 78465Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 78473Species Escherichia coli [TaxId:562] [54419] (9 PDB entries)
  8. 78484Domain d1d6zb2: 1d6z B:91-185 [38017]
    Other proteins in same PDB: d1d6za1, d1d6za4, d1d6zb1, d1d6zb4

Details for d1d6zb2

PDB Entry: 1d6z (more details), 2.1 Å

PDB Description: crystal structure of the aerobically freeze trapped rate-determining catalytic intermediate of e. coli copper-containing amine oxidase.

SCOP Domain Sequences for d1d6zb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d6zb2 d.17.2.1 (B:91-185) Copper amine oxidase, domains 1 and 2 {Escherichia coli}
krphplnaltadeikqaveivkasadfkpntrfteisllppdkeavwafalenkpvdqpr
kadvimldgkhiieavvdlqnnkllswqpikdahg

SCOP Domain Coordinates for d1d6zb2:

Click to download the PDB-style file with coordinates for d1d6zb2.
(The format of our PDB-style files is described here.)

Timeline for d1d6zb2: