SCOP 1.57: Domain d1d6zb2: 1d6z B:91-185

Lineage for d1d6zb2 (1d6z B:91-185)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.17: Cystatin-like [54402] (5 superfamilies)

4. Superfamily d.17.2: Copper amine oxidase, domains 1 and 2 [54416] (1 family)

5. Family d.17.2.1: Copper amine oxidase, domains 1 and 2 [54417] (1 protein)

6. Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)

7. Species Escherichia coli [TaxId:562] [54419] (9 PDB entries)

8. Domain d1d6zb2: 1d6z B:91-185 [38017]
   Other proteins in same PDB: d1d6za1, d1d6za4, d1d6zb1, d1d6zb4

Details for d1d6zb2

PDB Entry: 1d6z, 2.1 Å

PDB Description: crystal structure of the aerobically freeze trapped rate-determining catalytic intermediate of e. coli copper-containing amine oxidase.

SCOP Domain Sequences for d1d6zb2:

Sequence; same for both SEQRES and ATOM records:

>d1d6zb2 d.17.2.1 (B:91-185) Copper amine oxidase, domains 1 and 2 {Escherichia coli}
krphplnaltadeikqaveivkasadfkpntrfteisllppdkeavwafalenkpvdqpr
kadvimldgkhiieavvdlqnnkllswqpikdahg

Timeline for d1d6zb2:

• d1d6zb2 first appeared (with stable ids) in SCOP 1.55
  
• d1d6zb2 appears in SCOP 1.59
  
• d1d6zb2 appears in the current release, SCOPe 2.08