![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.17: Cystatin-like [54402] (5 superfamilies) |
![]() | Superfamily d.17.2: Copper amine oxidase, domains 1 and 2 [54416] (1 family) ![]() |
![]() | Family d.17.2.1: Copper amine oxidase, domains 1 and 2 [54417] (1 protein) |
![]() | Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [54419] (9 PDB entries) |
![]() | Domain d1d6za3: 1d6z A:186-300 [38016] Other proteins in same PDB: d1d6za1, d1d6za4, d1d6zb1, d1d6zb4 |
PDB Entry: 1d6z (more details), 2.1 Å
SCOP Domain Sequences for d1d6za3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d6za3 d.17.2.1 (A:186-300) Copper amine oxidase, domains 1 and 2 {Escherichia coli} mvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllkv isyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrva
Timeline for d1d6za3:
![]() Domains from other chains: (mouse over for more information) d1d6zb1, d1d6zb2, d1d6zb3, d1d6zb4 |