Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.17: Cystatin-like [54402] (5 superfamilies) |
Superfamily d.17.2: Copper amine oxidase, domains 1 and 2 [54416] (1 family) |
Family d.17.2.1: Copper amine oxidase, domains 1 and 2 [54417] (1 protein) |
Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species) |
Species Escherichia coli [TaxId:562] [54419] (9 PDB entries) |
Domain d1qakb3: 1qak B:186-300 [38014] Other proteins in same PDB: d1qaka1, d1qaka4, d1qakb1, d1qakb4 |
PDB Entry: 1qak (more details), 2 Å
SCOP Domain Sequences for d1qakb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qakb3 d.17.2.1 (B:186-300) Copper amine oxidase, domains 1 and 2 {Escherichia coli} mvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllkv isyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrva
Timeline for d1qakb3:
View in 3D Domains from other chains: (mouse over for more information) d1qaka1, d1qaka2, d1qaka3, d1qaka4 |