Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) |
Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins) duplication: contains two domains of this fold |
Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species) |
Species Escherichia coli [TaxId:562] [54419] (11 PDB entries) |
Domain d1qaka3: 1qak A:186-300 [38012] Other proteins in same PDB: d1qaka1, d1qaka4, d1qakb1, d1qakb4 |
PDB Entry: 1qak (more details), 2 Å
SCOP Domain Sequences for d1qaka3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qaka3 d.17.2.1 (A:186-300) Copper amine oxidase, domains 1 and 2 {Escherichia coli [TaxId: 562]} mvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllkv isyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrva
Timeline for d1qaka3:
View in 3D Domains from other chains: (mouse over for more information) d1qakb1, d1qakb2, d1qakb3, d1qakb4 |