![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) ![]() |
![]() | Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins) duplication: contains two domains of this fold |
![]() | Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [54419] (16 PDB entries) |
![]() | Domain d1oacb3: 1oac B:186-300 [38010] Other proteins in same PDB: d1oaca1, d1oaca4, d1oacb1, d1oacb4 complexed with ca, cu |
PDB Entry: 1oac (more details), 2 Å
SCOPe Domain Sequences for d1oacb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oacb3 d.17.2.1 (B:186-300) Copper amine oxidase, domains 1 and 2 {Escherichia coli [TaxId: 562]} mvllddfasvqniinnseefaaavkkrgitdakkvittpltvgyfdgkdglkqdarllkv isyldvgdgnywahpienlvavvdleqkkivkieegpvvpvpmtarpfdgrdrva
Timeline for d1oacb3:
![]() Domains from other chains: (mouse over for more information) d1oaca1, d1oaca2, d1oaca3, d1oaca4 |