SCOPe 2.08: Domain d1dvca_: 1dvc A:

Lineage for d1dvca_ (1dvc A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (7 families)
   has a additional strand at the N-terminus

5. Family d.17.1.2: Cystatins [54407] (7 proteins)
   automatically mapped to Pfam PF00031

6. Protein Cystatin A (stefin A) [54412] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54413] (12 PDB entries)

8. Domain d1dvca_: 1dvc A: [38003]

Details for d1dvca_

PDB Entry: 1dvc

PDB Description: solution nmr structure of human stefin a at ph 5.5 and 308k, nmr, minimized average structure

PDB Compounds: (A:) stefin a

SCOPe Domain Sequences for d1dvca_:

Sequence; same for both SEQRES and ATOM records:

>d1dvca_ d.17.1.2 (A:) Cystatin A (stefin A) {Human (Homo sapiens) [TaxId: 9606]}
mipgglseakpatpeiqeivdkvkpqleektnetygkleavqyktqvvagtnyyikvrag
dnkymhlkvfkslpgqnedlvltgyqvdknkddeltgf

Timeline for d1dvca_:

• d1dvca_ first appeared (with stable ids) in SCOP 1.55, called d1dvc__
  
• d1dvca_ appears in SCOPe 2.07