Lineage for d1a90a_ (1a90 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2180921Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2180922Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 2180959Family d.17.1.2: Cystatins [54407] (7 proteins)
    automatically mapped to Pfam PF00031
  6. 2180960Protein Cystatin [54410] (1 species)
  7. 2180961Species Chicken (Gallus gallus) [TaxId:9031] [54411] (3 PDB entries)
  8. 2180964Domain d1a90a_: 1a90 A: [38001]
    mutant

Details for d1a90a_

PDB Entry: 1a90 (more details)

PDB Description: recombinant mutant chicken egg white cystatin, nmr, 31 structures
PDB Compounds: (A:) cystatin

SCOPe Domain Sequences for d1a90a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a90a_ d.17.1.2 (A:) Cystatin {Chicken (Gallus gallus) [TaxId: 9031]}
gapvpvdendeglqralqfaiaeynrasndkyssrvvrvisakrqlvsgikyilqveigr
ttcpkssgdlqscefhdepelakyttctfvvysipwlnqiklleskcq

SCOPe Domain Coordinates for d1a90a_:

Click to download the PDB-style file with coordinates for d1a90a_.
(The format of our PDB-style files is described here.)

Timeline for d1a90a_: