Lineage for d1a67a_ (1a67 A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 718640Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 718641Superfamily d.17.1: Cystatin/monellin [54403] (5 families) (S)
    has a additional strand at the N-terminus
  5. 718665Family d.17.1.2: Cystatins [54407] (6 proteins)
  6. 718666Protein Cystatin [54410] (1 species)
  7. 718667Species Chicken (Gallus gallus) [TaxId:9031] [54411] (4 PDB entries)
  8. 718670Domain d1a67a_: 1a67 A: [38000]

Details for d1a67a_

PDB Entry: 1a67 (more details)

PDB Description: chicken egg white cystatin wildtype, nmr, 16 structures
PDB Compounds: (A:) cystatin

SCOP Domain Sequences for d1a67a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a67a_ d.17.1.2 (A:) Cystatin {Chicken (Gallus gallus) [TaxId: 9031]}
gapvpvdendeglqralqfamaeynrasndkyssrvvrvisakrqlvsgikyilqveigr
ttcpkssgdlqscefhdepemakyttctfvvysipwlnqiklleskcq

SCOP Domain Coordinates for d1a67a_:

Click to download the PDB-style file with coordinates for d1a67a_.
(The format of our PDB-style files is described here.)

Timeline for d1a67a_: