Lineage for d1mnl__ (1mnl -)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.17: Cystatin-like [54402] (5 superfamilies) 
Superfamily d.17.1: Cystatin/monellin [54403] (2 families) 
Family d.17.1.1: Monellin [54404] (1 protein) Protein Monellin, B & A chains together [54405] (1 species) Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [54406] (7 PDB entries) 
Domain d1mnl__: 1mnl - [37997]
Details for d1mnl__
PDB Entry: 1mnl (more details)
PDB Description: high-resolution solution structure of a sweet protein single-chain monellin (scm) determined by nuclear magnetic resonance spectroscopy and dynamical simulated annealing calculations, 21 structures
SCOP Domain Sequences for d1mnl__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mnl__ d.17.1.1 (-) Monellin, B & A chains together {Serendipity berry (Dioscoreophyllum cumminsii)}
geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyenereikgyeyql
yvyasdklfradisedyktrgrkllrfngpv
SCOP Domain Coordinates for d1mnl__:
Click to download the PDB-style file with coordinates for d1mnl__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mnl__:
- d1mnl__ first appeared (with stable ids) in SCOP 1.55
- d1mnl__ appears in SCOP 1.57
- d1mnl__ appears in SCOP 1.61
- d1mnl__ appears in the current release, SCOPe 2.08, called d1mnla_
View in 3D