Lineage for d1mnl__ (1mnl -)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 78424Fold d.17: Cystatin-like [54402] (5 superfamilies)
  4. 78425Superfamily d.17.1: Cystatin/monellin [54403] (2 families) (S)
  5. 78426Family d.17.1.1: Monellin [54404] (1 protein)
  6. 78427Protein Monellin, B & A chains together [54405] (1 species)
  7. 78428Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [54406] (6 PDB entries)
  8. 78439Domain d1mnl__: 1mnl - [37997]

Details for d1mnl__

PDB Entry: 1mnl (more details)

PDB Description: high-resolution solution structure of a sweet protein single-chain monellin (scm) determined by nuclear magnetic resonance spectroscopy and dynamical simulated annealing calculations, 21 structures

SCOP Domain Sequences for d1mnl__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mnl__ d.17.1.1 (-) Monellin, B & A chains together {Serendipity berry (Dioscoreophyllum cumminsii)}
geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyenereikgyeyql
yvyasdklfradisedyktrgrkllrfngpv

SCOP Domain Coordinates for d1mnl__:

Click to download the PDB-style file with coordinates for d1mnl__.
(The format of our PDB-style files is described here.)

Timeline for d1mnl__: