SCOPe 2.07: Domain d5qmab_: 5qma B:

Lineage for d5qmab_ (5qma B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.13: DsbA-like [100953] (4 proteins)
   contains an all-alpha subdomain insertion

6. Protein Disulfide-bond formation facilitator (DsbA) [100954] (4 species)
   the insert subdomain is a 4-helical bundle

7. Species Escherichia coli [TaxId:562] [100955] (185 PDB entries)

8. Domain d5qmab_: 5qma B: [379969]
   automated match to d1fvka_

Details for d5qmab_

PDB Entry: 5qma, 2.14 Å

PDB Description: group deposition of library data - crystal structure of ecdsba after initial refinement with no ligand modelled (structure e5_1)

PDB Compounds: (B:) thiol:disulfide interchange protein

SCOPe Domain Sequences for d5qmab_:

Sequence; same for both SEQRES and ATOM records:

>d5qmab_ c.47.1.13 (B:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]}
aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
tvkylsek

Timeline for d5qmab_:

• d5qmab_ is new in SCOPe 2.07-stable
  
• d5qmab_ appears in the current release, SCOPe 2.08