Lineage for d1fa3a_ (1fa3 A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1895674Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1895675Superfamily d.17.1: Cystatin/monellin [54403] (7 families) (S)
    has a additional strand at the N-terminus
  5. 1895676Family d.17.1.1: Monellin [54404] (2 proteins)
  6. 1895677Protein Monellin, B & A chains together [54405] (1 species)
  7. 1895678Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [54406] (12 PDB entries)
  8. 1895695Domain d1fa3a_: 1fa3 A: [37996]
    single-chain version

Details for d1fa3a_

PDB Entry: 1fa3 (more details)

PDB Description: solution structure of mnei, a sweet protein
PDB Compounds: (A:) mnei sweet protein related to monellin

SCOPe Domain Sequences for d1fa3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fa3a_ d.17.1.1 (A:) Monellin, B & A chains together {Serendipity berry (Dioscoreophyllum cumminsii) [TaxId: 3457]}
geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyenegfreikgyey
qlyvyasdklfradisedyktrgrkllrfngpvppp

SCOPe Domain Coordinates for d1fa3a_:

Click to download the PDB-style file with coordinates for d1fa3a_.
(The format of our PDB-style files is described here.)

Timeline for d1fa3a_: