Lineage for d1fa3a_ (1fa3 A:)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.17: Cystatin-like [54402] (5 superfamilies) 
Superfamily d.17.1: Cystatin/monellin [54403] (2 families) 
Family d.17.1.1: Monellin [54404] (1 protein) Protein Monellin, B & A chains together [54405] (1 species) Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [54406] (7 PDB entries) 
Domain d1fa3a_: 1fa3 A: [37996]
Details for d1fa3a_
PDB Entry: 1fa3 (more details)
PDB Description: solution structure of mnei, a sweet protein
SCOP Domain Sequences for d1fa3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fa3a_ d.17.1.1 (A:) Monellin, B & A chains together {Serendipity berry (Dioscoreophyllum cumminsii)}
geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyenegfreikgyey
qlyvyasdklfradisedyktrgrkllrfngpvppp
SCOP Domain Coordinates for d1fa3a_:
Click to download the PDB-style file with coordinates for d1fa3a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fa3a_:
- d1fa3a_ first appeared (with stable ids) in SCOP 1.55
- d1fa3a_ appears in SCOP 1.57
- d1fa3a_ appears in SCOP 1.61
- d1fa3a_ appears in the current release, SCOPe 2.08
View in 3D