SCOP 1.75: Domain d3mon.7: 3mon F:,E:

Lineage for d3mon.7 (3mon F:,E:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (6 families)
   has a additional strand at the N-terminus

5. Family d.17.1.1: Monellin [54404] (1 protein)

6. Protein Monellin, B & A chains together [54405] (1 species)

7. Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [54406] (12 PDB entries)

8. Domain d3mon.7: 3mon F:,E: [37994]

Details for d3mon.7

PDB Entry: 3mon, 2.8 Å

PDB Description: crystal structures of two intensely sweet proteins

PDB Compounds: (E:) monellin, (F:) monellin

SCOP Domain Sequences for d3mon.7:

Sequence; same for both SEQRES and ATOM records:

>g3mon.7 d.17.1.1 (F:,E:) Monellin, B & A chains together {Serendipity berry (Dioscoreophyllum cumminsii) [TaxId: 3457]}
geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyeneXreikgyeyq
lyvyasdklfradisedyktrgrkllrfngpvppp

Timeline for d3mon.7:

• d3mon.7 first appeared (with stable ids) in SCOP 1.55
  
• d3mon.7 appears in SCOP 1.73
  
• d3mon.7 appears in SCOPe 2.01
  
• d3mon.7 appears in the current release, SCOPe 2.08