Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
Fold d.17: Cystatin-like [54402] (5 superfamilies) |
Superfamily d.17.1: Cystatin/monellin [54403] (2 families) |
Family d.17.1.1: Monellin [54404] (1 protein) |
Protein Monellin, B & A chains together [54405] (1 species) |
Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [54406] (7 PDB entries) |
Domain d3mon.7: 3mon F:,E: [37994] |
PDB Entry: 3mon (more details), 2.8 Å
SCOP Domain Sequences for d3mon.7:
Sequence; same for both SEQRES and ATOM records: (download)
>g3mon.7 d.17.1.1 (F:,E:) Monellin, B & A chains together {Serendipity berry (Dioscoreophyllum cumminsii)} geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyeneXreikgyeyq lyvyasdklfradisedyktrgrkllrfngpvppp
Timeline for d3mon.7: