SCOP 1.59: Domain d3mon.6: 3mon D:,C:

Lineage for d3mon.6 (3mon D:,C:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.17: Cystatin-like [54402] (5 superfamilies)

4. Superfamily d.17.1: Cystatin/monellin [54403] (2 families)

5. Family d.17.1.1: Monellin [54404] (1 protein)

6. Protein Monellin, B & A chains together [54405] (1 species)

7. Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [54406] (7 PDB entries)

8. Domain d3mon.6: 3mon D:,C: [37993]

Details for d3mon.6

PDB Entry: 3mon, 2.8 Å

PDB Description: crystal structures of two intensely sweet proteins

SCOP Domain Sequences for d3mon.6:

Sequence; same for both SEQRES and ATOM records:

>g3mon.6 d.17.1.1 (D:,C:) Monellin, B & A chains together {Serendipity berry (Dioscoreophyllum cumminsii)}
geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyeneXreikgyeyq
lyvyasdklfradisedyktrgrkllrfngpvppp

Timeline for d3mon.6:

• d3mon.6 first appeared (with stable ids) in SCOP 1.55
  
• d3mon.6 appears in SCOP 1.57
  
• d3mon.6 appears in SCOP 1.61
  
• d3mon.6 appears in the current release, SCOPe 2.08