Lineage for d3mon.5 (3mon B:,A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 78424Fold d.17: Cystatin-like [54402] (5 superfamilies)
  4. 78425Superfamily d.17.1: Cystatin/monellin [54403] (2 families) (S)
  5. 78426Family d.17.1.1: Monellin [54404] (1 protein)
  6. 78427Protein Monellin, B & A chains together [54405] (1 species)
  7. 78428Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [54406] (6 PDB entries)
  8. 78433Domain d3mon.5: 3mon B:,A: [37992]

Details for d3mon.5

PDB Entry: 3mon (more details), 2.8 Å

PDB Description: crystal structures of two intensely sweet proteins

SCOP Domain Sequences for d3mon.5:

Sequence; same for both SEQRES and ATOM records: (download)

>g3mon.5 d.17.1.1 (B:,A:) Monellin, B & A chains together {Serendipity berry (Dioscoreophyllum cumminsii)}
geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyeneXreikgyeyq
lyvyasdklfradisedyktrgrkllrfngpvppp

SCOP Domain Coordinates for d3mon.5:

Click to download the PDB-style file with coordinates for d3mon.5.
(The format of our PDB-style files is described here.)

Timeline for d3mon.5: