Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.0: automated matches [191342] (1 protein) not a true family |
Protein automated matches [190230] (23 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187072] (53 PDB entries) |
Domain d6p3qa1: 6p3q A:4-343 [379909] Other proteins in same PDB: d6p3qa2, d6p3qb2 automated match to d1tl9a_ |
PDB Entry: 6p3q (more details), 2.8 Å
SCOPe Domain Sequences for d6p3qa1:
Sequence, based on SEQRES records: (download)
>d6p3qa1 d.3.1.0 (A:4-343) automated matches {Human (Homo sapiens) [TaxId: 9606]} cvkpyedqnysalrrdcrrrkvlfedplfpatddslyykgtpgpavrwkrpkgicedprl fvdgisshdlhqgqvgncwfvaacsslasreslwqkvipdwkeqewdpekpnayagifhf hfwrfgewvdvviddrlptvnnqliychsnsrnefwcalvekayaklagcyqaldggnta dalvdftggvsepidltegdfandetkrnqlfermlkvhsrgglisasikavtaadmear lacglvkghayavtdvrkvrlghgllaffksekldmirlrnpwgerewngpwsdtseewq kvskserekmgvtvqddgefwmtfedvcryftdiikcrvi
>d6p3qa1 d.3.1.0 (A:4-343) automated matches {Human (Homo sapiens) [TaxId: 9606]} cvkpyedqnysalrrdcrrrkvlfedplfpatddslyykgtpgpavrwkrpkgicedprl fvdgishdlhqgqvgncwfvaacsslasreslwqkvipdwkeqewdpekpnayagifhfh fwrfgewvdvviddrlptvnnqliychsnsrnefwcalvekayaklagcyqaldggntad alvdftggvsepidltegdfandetkrnqlfermlkvhsrgglisasikavtaadmearl acglvkghayavtdvrkvrlghgllaffksekldmirlrnpwgerewngpwsdtseewqk vskserekmgvtvqddgefwmtfedvcryftdiikcrvi
Timeline for d6p3qa1: