Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.17: Cystatin-like [54402] (5 superfamilies) |
Superfamily d.17.1: Cystatin/monellin [54403] (2 families) |
Family d.17.1.1: Monellin [54404] (1 protein) |
Protein Monellin, B & A chains together [54405] (1 species) |
Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [54406] (6 PDB entries) |
Domain d4mon.3: 4mon B:,A: [37990] |
PDB Entry: 4mon (more details), 2.3 Å
SCOP Domain Sequences for d4mon.3:
Sequence; same for both SEQRES and ATOM records: (download)
>g4mon.3 d.17.1.1 (B:,A:) Monellin, B & A chains together {Serendipity berry (Dioscoreophyllum cumminsii)} geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyeneXreikgyeyq lyvyasdklfradisedyktrgrkllrfngpvppp
Timeline for d4mon.3:
View in 3D Domains from other chains: (mouse over for more information) d4mon.4, d4mon.4, d4mon.4, d4mon.4 |