Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.1: Cystatin/monellin [54403] (3 families) has a additional strand at the N-terminus |
Family d.17.1.1: Monellin [54404] (1 protein) |
Protein Monellin, B & A chains together [54405] (1 species) |
Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [54406] (11 PDB entries) |
Domain d1molb_: 1mol B: [37989] single-chain version |
PDB Entry: 1mol (more details), 1.7 Å
SCOP Domain Sequences for d1molb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1molb_ d.17.1.1 (B:) Monellin, B & A chains together {Serendipity berry (Dioscoreophyllum cumminsii)} geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyenereikgyeyql yvyasdklfradisedyktrgrkllrfngpvppp
Timeline for d1molb_: