SCOP 1.59: Domain d1molb_: 1mol B:

Lineage for d1molb_ (1mol B:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.17: Cystatin-like [54402] (5 superfamilies)

4. Superfamily d.17.1: Cystatin/monellin [54403] (2 families)

5. Family d.17.1.1: Monellin [54404] (1 protein)

6. Protein Monellin, B & A chains together [54405] (1 species)

7. Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [54406] (7 PDB entries)

8. Domain d1molb_: 1mol B: [37989]

Details for d1molb_

PDB Entry: 1mol, 1.7 Å

PDB Description: two crystal structures of a potently sweet protein: natural monellin at 2.75 angstroms resolution and single-chain monellin at 1.7 angstroms resolution

SCOP Domain Sequences for d1molb_:

Sequence; same for both SEQRES and ATOM records:

>d1molb_ d.17.1.1 (B:) Monellin, B & A chains together {Serendipity berry (Dioscoreophyllum cumminsii)}
geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyenereikgyeyql
yvyasdklfradisedyktrgrkllrfngpvppp

Timeline for d1molb_:

• d1molb_ first appeared (with stable ids) in SCOP 1.55
  
• d1molb_ appears in SCOP 1.57
  
• d1molb_ appears in SCOP 1.61
  
• d1molb_ appears in the current release, SCOPe 2.08