SCOPe 2.05: Domain d1mola_: 1mol A:

Lineage for d1mola_ (1mol A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (7 families)
   has a additional strand at the N-terminus

5. Family d.17.1.1: Monellin [54404] (2 proteins)

6. Protein Monellin, B & A chains together [54405] (1 species)

7. Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [54406] (12 PDB entries)

8. Domain d1mola_: 1mol A: [37988]
   single-chain version

Details for d1mola_

PDB Entry: 1mol, 1.7 Å

PDB Description: two crystal structures of a potently sweet protein: natural monellin at 2.75 angstroms resolution and single-chain monellin at 1.7 angstroms resolution

PDB Compounds: (A:) monellin

SCOPe Domain Sequences for d1mola_:

Sequence; same for both SEQRES and ATOM records:

>d1mola_ d.17.1.1 (A:) Monellin, B & A chains together {Serendipity berry (Dioscoreophyllum cumminsii) [TaxId: 3457]}
geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyenereikgyeyql
yvyasdklfradisedyktrgrkllrfngpvppp

Timeline for d1mola_:

• d1mola_ first appeared (with stable ids) in SCOP 1.55
  
• d1mola_ appears in SCOPe 2.04
  
• d1mola_ appears in SCOPe 2.06
  
• d1mola_ appears in the current release, SCOPe 2.08