Lineage for d1mola_ (1mol A:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 78424Fold d.17: Cystatin-like [54402] (5 superfamilies)
  4. 78425Superfamily d.17.1: Cystatin/monellin [54403] (2 families) (S)
  5. 78426Family d.17.1.1: Monellin [54404] (1 protein)
  6. 78427Protein Monellin, B & A chains together [54405] (1 species)
  7. 78428Species Serendipity berry (Dioscoreophyllum cumminsii) [TaxId:3457] [54406] (6 PDB entries)
  8. 78429Domain d1mola_: 1mol A: [37988]

Details for d1mola_

PDB Entry: 1mol (more details), 1.7 Å

PDB Description: two crystal structures of a potently sweet protein: natural monellin at 2.75 angstroms resolution and single-chain monellin at 1.7 angstroms resolution

SCOP Domain Sequences for d1mola_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mola_ d.17.1.1 (A:) Monellin, B & A chains together {Serendipity berry (Dioscoreophyllum cumminsii)}
geweiidigpftqnlgkfavdeenkigqygrltfnkvirpcmkktiyenereikgyeyql
yvyasdklfradisedyktrgrkllrfngpvppp

SCOP Domain Coordinates for d1mola_:

Click to download the PDB-style file with coordinates for d1mola_.
(The format of our PDB-style files is described here.)

Timeline for d1mola_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1molb_