Lineage for d1gnda2 (1gnd A:292-388)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1639904Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 1639905Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 1640275Family d.16.1.6: GDI-like [54399] (2 proteins)
    Similar to FAD-linked reductases in both domains but does not bind FAD
  6. 1640276Protein Guanine nucleotide dissociation inhibitor, GDI [54400] (2 species)
  7. 1640280Species Cow (Bos taurus) [TaxId:9913] [54401] (3 PDB entries)
  8. 1640282Domain d1gnda2: 1gnd A:292-388 [37987]
    Other proteins in same PDB: d1gnda1

Details for d1gnda2

PDB Entry: 1gnd (more details), 1.81 Å

PDB Description: guanine nucleotide dissociation inhibitor, alpha-isoform
PDB Compounds: (A:) guanine nucleotide dissociation inhibitor

SCOPe Domain Sequences for d1gnda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gnda2 d.16.1.6 (A:292-388) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]}
rkagqviriicilshpikntndanscqiiipqnqvnrksdiyvcmisyahnvaaqgkyia
iasttvettdpekevepalellepidqkfvaisdlye

SCOPe Domain Coordinates for d1gnda2:

Click to download the PDB-style file with coordinates for d1gnda2.
(The format of our PDB-style files is described here.)

Timeline for d1gnda2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gnda1