Lineage for d1d5ta2 (1d5t A:292-388)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1404207Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 1404208Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 1404578Family d.16.1.6: GDI-like [54399] (2 proteins)
    Similar to FAD-linked reductases in both domains but does not bind FAD
  6. 1404579Protein Guanine nucleotide dissociation inhibitor, GDI [54400] (2 species)
  7. 1404588Species Cow (Bos taurus) [TaxId:9913] [54401] (3 PDB entries)
  8. 1404589Domain d1d5ta2: 1d5t A:292-388 [37986]
    Other proteins in same PDB: d1d5ta1
    complexed with so4

Details for d1d5ta2

PDB Entry: 1d5t (more details), 1.04 Å

PDB Description: guanine nucleotide dissociation inhibitor, alpha-isoform
PDB Compounds: (A:) guanine nucleotide dissociation inhibitor

SCOPe Domain Sequences for d1d5ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d5ta2 d.16.1.6 (A:292-388) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]}
rkagqviriicilshpikntndanscqiiipqnqvnrksdiyvcmisyahnvaaqgkyia
iasttvettdpekevepalgllepidqkfvaisdlye

SCOPe Domain Coordinates for d1d5ta2:

Click to download the PDB-style file with coordinates for d1d5ta2.
(The format of our PDB-style files is described here.)

Timeline for d1d5ta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1d5ta1