Lineage for d5qkfa_ (5qkf A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878376Family c.47.1.13: DsbA-like [100953] (4 proteins)
    contains an all-alpha subdomain insertion
  6. 2878377Protein Disulfide-bond formation facilitator (DsbA) [100954] (4 species)
    the insert subdomain is a 4-helical bundle
  7. 2878387Species Escherichia coli [TaxId:562] [100955] (185 PDB entries)
  8. 2878669Domain d5qkfa_: 5qkf A: [379844]
    automated match to d1fvka_

Details for d5qkfa_

PDB Entry: 5qkf (more details), 2.14 Å

PDB Description: group deposition of library data - crystal structure of ecdsba after initial refinement with no ligand modelled (structure a12_1)
PDB Compounds: (A:) thiol:disulfide interchange protein

SCOPe Domain Sequences for d5qkfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5qkfa_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]}
aqyedgkqyttlekpvagapqvleffsffcphcyqfeevlhisdnvkkklpegvkmtkyh
vnfmggdlgkdltqawavamalgvedkvtvplfegvqktqtirsasdirdvfinagikge
eydaawnsfvvkslvaqqekaaadvqlrgvpamfvngkyqlnpqgmdtsnmdvfvqqyad
tvkylsek

SCOPe Domain Coordinates for d5qkfa_:

Click to download the PDB-style file with coordinates for d5qkfa_.
(The format of our PDB-style files is described here.)

Timeline for d5qkfa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5qkfb_