SCOPe 2.07: Domain d6jbkg2: 6jbk G:147-372

Lineage for d6jbkg2 (6jbk G:147-372)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein Actin [53073] (10 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (78 PDB entries)
   Uniprot P02568 ! SQ 02568

8. Domain d6jbkg2: 6jbk G:147-372 [379843]
   automated match to d1ijja2
   complexed with atp, ca; mutant

Details for d6jbkg2

PDB Entry: 6jbk, 2.45 Å

PDB Description: crystal structure of an actin monomer in complex with the nucleator cordon-bleu wh2-motif peptide mutant. t22v

PDB Compounds: (G:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d6jbkg2:

Sequence; same for both SEQRES and ATOM records:

>d6jbkg2 c.55.1.1 (G:147-372) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhr

Timeline for d6jbkg2:

• d6jbkg2 is new in SCOPe 2.07-stable
  
• d6jbkg2 appears in the current release, SCOPe 2.08