![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
![]() | Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families) ![]() N-terminal domain is beta/beta/alpha common fold |
![]() | Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (5 proteins) |
![]() | Protein L-aminoacid oxidase [54397] (2 species) |
![]() | Species Malayan pit viper (Calloselasma rhodostoma) [TaxId:8717] [54398] (2 PDB entries) |
![]() | Domain d1f8sf2: 1f8s F:320-432 [37983] Other proteins in same PDB: d1f8sa1, d1f8sb1, d1f8sc1, d1f8sd1, d1f8se1, d1f8sf1, d1f8sg1, d1f8sh1 |
PDB Entry: 1f8s (more details), 2 Å
SCOP Domain Sequences for d1f8sf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f8sf2 d.16.1.5 (F:320-432) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma)} hyrsgtkifltcttkfweddgihggksttdlpsrfiyypnhnftngvgviiaygigddan ffqaldfkdcadivfndlslihqlpkkdiqsfcypsviqkwsldkyamggitt
Timeline for d1f8sf2: