SCOPe 2.07: Domain d6lhql_: 6lhq L:

Lineage for d6lhql_ (6lhq L:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries)

8. Domain d6lhql_: 6lhq L: [379800]
   Other proteins in same PDB: d6lhqa_, d6lhqb_, d6lhqc_, d6lhqh_
   automated match to d1rvfl_
   complexed with sph

Details for d6lhql_

PDB Entry: 6lhq, 3.06 Å

PDB Description: the cryo-em structure of coxsackievirus a16 mature virion in complex with fab na9d7

PDB Compounds: (L:) light chain variable region of Fab NA9D7

SCOPe Domain Sequences for d6lhql_:

Sequence; same for both SEQRES and ATOM records:

>d6lhql_ b.1.1.1 (L:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
eivltqspttmaaspgekititcsasssissnylhwyqqkpgfspklliyrtsnlasgvp
arfsgsgsgtsysltigtmeaedvatyycqqgssiphtfgggtkleik

Timeline for d6lhql_:

• d6lhql_ is new in SCOPe 2.07-stable
  
• d6lhql_ appears in the current release, SCOPe 2.08