SCOP 1.63: Domain d1f8sc2: 1f8s C:320-432

Lineage for d1f8sc2 (1f8s C:320-432)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (6 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (3 proteins)

6. Protein L-aminoacid oxidase [54397] (1 species)

7. Species Malayan pit viper (Calloselasma rhodostoma) [TaxId:8717] [54398] (2 PDB entries)

8. Domain d1f8sc2: 1f8s C:320-432 [37980]
   Other proteins in same PDB: d1f8sa1, d1f8sb1, d1f8sc1, d1f8sd1, d1f8se1, d1f8sf1, d1f8sg1, d1f8sh1

Details for d1f8sc2

PDB Entry: 1f8s, 2 Å

PDB Description: crystal structure of l-amino acid oxidase from calloselasma rhodostoma, complexed with three molecules of o-aminobenzoate.

SCOP Domain Sequences for d1f8sc2:

Sequence; same for both SEQRES and ATOM records:

>d1f8sc2 d.16.1.5 (C:320-432) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma)}
hyrsgtkifltcttkfweddgihggksttdlpsrfiyypnhnftngvgviiaygigddan
ffqaldfkdcadivfndlslihqlpkkdiqsfcypsviqkwsldkyamggitt

Timeline for d1f8sc2:

• d1f8sc2 first appeared (with stable ids) in SCOP 1.55
  
• d1f8sc2 appears in SCOP 1.61
  
• d1f8sc2 appears in SCOP 1.65
  
• d1f8sc2 appears in the current release, SCOPe 2.08